ELISA Recombinant UPF0542 protein C5orf43(C5orf43)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens ()
Uniprot NO.:Q7Z3B0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MFDIKAWAEYVVEWAAKDPYGFLTTVILALTPLFLASAVLSWKLAKMIEAREKEQKKKQK RQENIAKAKRLKKD
Protein Names:Recommended name: UPF0542 protein C5orf43
Gene Names:Name:C5orf43
Expression Region:1-74
Sequence Info:fµLl length protein
Internal Reference:
CSB-CF768759HU
Website URL:
/shop/csb-cf768759hu-elisa-recombinant-upf0542-protein-c5orf43-c5orf43-140542