ELISA Recombinant UPF0542 protein C5orf43(C5orf43)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q7Z3B0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MFDIKAWAEYVVEWAAKDPYGFLTTVILALTPLFLASAVLSWKLAKMIEAREKEQKKKQK RQENIAKAKRLKKD Protein Names:Recommended name: UPF0542 protein C5orf43 Gene Names:Name:C5orf43 Expression Region:1-74 Sequence Info:fµLl length protein