ELISA Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 11(PCR11)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:Q9SX24
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNLSSNDQPSQGRIKAKDWSTDLCECWMDINSCCLTCWCPCVAFGRIAEVVDRGSTSCGV SGAMYMIIFmLTGYGGSSLYSCFYRTKLRAQYNLKERPCCDCCVHFCCEPCALCQEYRQL QHNRDLDLVIGWHGNMERHARLAASTPSAPPLQAPMSRLV
Protein Names:Recommended name: Protein PLANT CADMIUM RESISTANCE 11 Short name= AtPCR11
Gene Names:Name:PCR11 Ordered Locus Names:At1g68610 ORF Names:F24J5.15
Expression Region:1-160
Sequence Info:fµLl length protein
Internal Reference:
CSB-CF874547DOA
Website URL:
/shop/csb-cf874547doa-elisa-recombinant-arabidopsis-thaliana-protein-plant-cadmium-resistance-11-pcr11-117040