ELISA Recombinant Triggering receptor expressed on myeloid cells 2(TREM2),partial
Quantity: 200µg. Other Quantitys are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Immunology
Uniprot ID: Q9NZC2
Gene Names: TREM2
Organism: Homo sapiens ()
AA Sequence: HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTS
Expression Region: 19-174aa
Sequence Info: ExtracellµLar Domain
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 21.4 kDa
Alternative Name(s): Triggering receptor expressed on monocytes 2
Relevance: May have a role in chronic inflammations and may stimµLate production of constitutive rather than inflammatory chemokines and cytokines. Forms a receptor signaling complex with TYROBP and triggers activation of the immune responses in macrophages and dendritic cells.
Reference: "Inflammatory responses can be triggered by TREM-1, a novel receptor expressed on neutrophils and monocytes."Bouchon A., Dietrich J., Colonna M.J. Immunol. 164:4991-4995(2000)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Internal Reference:
CSB-EP024405HU
Website URL:
/shop/csb-ep024405hu-elisa-recombinant-triggering-receptor-expressed-on-myeloid-cells-2-trem2-partial-140103